PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36710.1
Common NameAtHAM4, C7A10.650, HAM4, SCL15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 486aa    MW: 54148.3 Da    PI: 4.9698
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36710.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3342.8e-1021234852374
         GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +e L++++++v+s++l+laq +L+rl+++ +sp+g+p+qR+a+yf+eAL + l++     ++  p + +s+++ ++++ a k +s +sPi+ fsh+ta
  AT4G36710.1 123 IEDLIRVVDCVESDELQLAQVVLSRLNQRlRSPAGRPLQRAAFYFKEALGSFLTG-----SNRNPIRLSSWSEIVQRIRAIKEYSGISPIPLFSHFTA 215
                  678*************************99*************************.....888899999999************************** PP

         GRAS  99 NqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  NqaIl++++++     vH++Df+i+ G+Q+++L++++++++ +   lR+T+v+++e   + e++ ++e+L++fA+e++++f+++++++k++e+l++++
  AT4G36710.1 216 NQAILDSLSSQsssPFVHVVDFEIGFGGQYASLMREITEKSVSGGFLRVTAVVAEE--CAVETRLVKENLTQFAAEMKIRFQIEFVLMKTFEMLSFKA 311
                  ********99977789**************************************66..9*************************************** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyysalfdsleaklpreseerikvEre 288
                  +r+ +gE ++V ++ +++r l       s ++++++ ++++sPkvvv+v++e  ++  +s+sF ++f++ale+y+++++sl+a +p+ +  ++ vE++
  AT4G36710.1 312 IRFVEGERTVVLISPAIFRRL-------SGITDFVNNLRRVSPKVVVFVDSEgwTEIaGSGSFRREFVSALEFYTMVLESLDAAAPPGDLVKKIVEAF 402
                  ********************9.......44677*******************76677899************************************** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +l+++i+ +v ++ ++   rh+  ++Wre++ +aG++p++ls++a  qa++ll+k +++g++v +++g+lvl+W++r+Lv++SaWr
  AT4G36710.1 403 VLRPKISAAVETAADR---RHTGEMTWREAFCAAGMRPIQLSQFADFQAECLLEKAQVRGFHVAKRQGELVLCWHGRALVATSAWR 485
                  ************9999...9*****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.84496465IPR005202Transcription factor GRAS
PfamPF035149.7E-100123485IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MKIPASSPQD TTNNNNNTNS TDSNHLSMDE HVMRSMDWDS IMKELELDDD SAPNSLKTGF  60
TTTTTDSTIL PLYAVDSNLP GFPDQIQPSD FESSSDVYPG QNQTTGYGFN SLDSVDNGGF  120
DFIEDLIRVV DCVESDELQL AQVVLSRLNQ RLRSPAGRPL QRAAFYFKEA LGSFLTGSNR  180
NPIRLSSWSE IVQRIRAIKE YSGISPIPLF SHFTANQAIL DSLSSQSSSP FVHVVDFEIG  240
FGGQYASLMR EITEKSVSGG FLRVTAVVAE ECAVETRLVK ENLTQFAAEM KIRFQIEFVL  300
MKTFEMLSFK AIRFVEGERT VVLISPAIFR RLSGITDFVN NLRRVSPKVV VFVDSEGWTE  360
IAGSGSFRRE FVSALEFYTM VLESLDAAAP PGDLVKKIVE AFVLRPKISA AVETAADRRH  420
TGEMTWREAF CAAGMRPIQL SQFADFQAEC LLEKAQVRGF HVAKRQGELV LCWHGRALVA  480
TSAWRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1815648536375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.313040.0flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402561960.0
Genevisible246230_at0.0
Expression AtlasAT4G36710-
AtGenExpressAT4G36710-
ATTED-IIAT4G36710-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. acts as an HDA19-associated regulator to repress embryonic traits in seedlings
    [PMID: 26129778]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G46480
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1184970.0AK118497.1 Arabidopsis thaliana At4g36710 mRNA for ap2 SCARECROW-like protein, complete cds, clone: RAFL19-73-D11.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195389.40.0scarecrow-like protein 15
SwissprotO232100.0SCL15_ARATH; Scarecrow-like protein 15
TrEMBLR0F5610.0R0F561_9BRAS; Uncharacterized protein
STRINGAT4G36710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42912857
Representative plantOGRP10323610
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  5. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  6. Yoo BC, et al.
    A systemic small RNA signaling system in plants.
    Plant Cell, 2004. 16(8): p. 1979-2000
    [PMID:15258266]
  7. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  8. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  9. Ohashi-Ito K,Kubo M,Demura T,Fukuda H
    Class III homeodomain leucine-zipper proteins regulate xylem cell differentiation.
    Plant Cell Physiol., 2005. 46(10): p. 1646-56
    [PMID:16081527]
  10. Pineau C, et al.
    hca: an Arabidopsis mutant exhibiting unusual cambial activity and altered vascular patterning.
    Plant J., 2005. 44(2): p. 271-89
    [PMID:16212606]
  11. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  12. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  13. Engstrom EM, et al.
    Arabidopsis homologs of the petunia hairy meristem gene are required for maintenance of shoot and root indeterminacy.
    Plant Physiol., 2011. 155(2): p. 735-50
    [PMID:21173022]
  14. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  15. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  16. Zhou Y, et al.
    Control of plant stem cell function by conserved interacting transcriptional regulators.
    Nature, 2015. 517(7534): p. 377-80
    [PMID:25363783]
  17. Gao MJ, et al.
    SCARECROW-LIKE15 interacts with HISTONE DEACETYLASE19 and is essential for repressing the seed maturation programme.
    Nat Commun, 2015. 6: p. 7243
    [PMID:26129778]